Shenzhen Simeiquan Biotechnology Co., Ltd.

Igf1des, Igf1lr3, Igf1human Des1-3 manufacturer / supplier in China, offering Human Growth Peptide Igf1des (1mg) in Stock Igf1human Des1-3, Anabolic Androgenic Steroids Powder Methenolone Enanthate for Bodybuilding, 164656-23-9 Dutasteride for Erectile Dysfunction Treatment Avodart and so on.

Supplier Homepage Product List Peptide and Human Growth Steroid Human Growth Peptide Igf1des (1mg) in Stock Igf1human Des1-3

Human Growth Peptide Igf1des (1mg) in Stock Igf1human Des1-3

FOB Price:US $1 / vials
Min. Order (vials) FOB Price
10+ US $1 / vials
Get Latest Price
Min. Order: 10 vials
Production Capacity: 50000vials/Month
Transport Package: 10vials/Kit or as Require
Payment Terms: T/T, Western Union, Money Gram

Basic Info.

Model NO.:IGF1des
Powder:Yes
Customized:Non-Customized
Certification:GMP, ISO 9001, USP
Suitable for:Adult
State:Solid
Purity:>98%
Color:White Crystalline Powder
Package:1mg
Trademark:Simeiquan
Specification:99% min
Origin:China
HS Code:3001200020

Product Description

IGFDES

Insulin Like Growth Factor (IGF)- (4-70), otherwise known as IGF-DES, produced in E. coli, is a single, non-glycosylated, polypeptide chain containing 67 amino acids and having a molecular mass of 7,372 Da. In vitro studies demonstrate that at equal doses DES (1-3) IGF is ten times more potent than IGF- at stimulating hypertrophy and proliferation in cultured cells. It is likely generated through post-translational modification in the sequence of circulating mature IGF- via protease action. 

IGF- DES is a cleaved form of IGF- and contains amino acids 4-70. This structure has allowed the effects of the IGF- protein to be amplified in the more stable form of the DES 1,3 molecule peptide protein fragment of Insulin-like growth factor 1. The IGF- DES, or insulin-like growth factor DES, comes from the IGF- family of peptides that play important roles in mammalian growth and development. IGF1 mediates many of the growth-promoting effects of growth hormone and IGF- DES, although shorter, pacts an equal amount of physiological altering protein physical changes. Early studies showed that growth hormone did not directly stimulate the incorporation of sulfate into cartilage, but rather acted through a serum factor, termed 'sulfation factor,' which later became known as 'somatomedin' or IGF- and more recently through truncation, DES IGF-.

 

Insulin-Like Growth Factor-1 DES (1-3)

Sequence: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA 
Molar Mass: 7,372 Da 
Synonyms:  Des(1-3), Des1-3, Des 1-3, Des (1-3), (4-70)

DES (1-3)



Human Growth Peptide Igf1des (1mg) in Stock Igf1human Des1-3


Our Competitive Advantages 
1.Rich experience.
Our company is a professional production leading factory in China in pharmaceutical area of many years
2.Superior quality, purity and favourable.
Our company is a professional leading manufacturer in China in pharmaceutical area.Good quality is one of our secret success.
3.Safe and fast delivery.
We have GOLDEN FORWARDER and Hongkong Warehouse  so we can delivery quickly and safely.
4.Package: Professional packing with professional materials.
5.Competitive Prices : Low price with high qulity.

                   Peptide  List
 
 
Product Name
 
Purity
 
       Specification
 
GHRP-2
 
98%min
 
5mg/vial,  10vial/kit
 
GHRP-6
 
98%min
 
5mg/vial,  10vial/kit
CJC-1295without DAC(CJC-1293) 
98%min
 
2mg/vial,  10vial/kit
 
CJC-1295 (DAC)
 
98%min
 
2mg/vial,  10vial/kit
 
Sermorelin Acetate
 
98%min
 
2mg/vial,  10vial/kit
 
IGF-Lr3
 
98%min
 
1mg/vial,  10vial/kit
 
IGF-DES 
 
 
98%min
 
1mg/vial,  10vial/kit
 
PT-141
 
98%min
 
10mg/vial,  10vial/kit
 
Hexarelin
 
98%min
 
2mg/vial,  10vial/kit
 
MT-II (Melanotan II )
 
98%min
 
10mg/vial,  10vial/kit
 
Ipamorealin
 
98%min
 
2mg/vial,  10vial/kit
 
TB-500
 
98%min
 
2mg/vial,5mg/vial,10mg/vial, 10vial/kit
 
Should any interest on any of the above peptides, welcome to contact us.
 
Human Growth Peptide Igf1des (1mg) in Stock Igf1human Des1-3
 
Send your message to this supplier
Avatar
Mr. Thyen
*From
To Mr. Thyen
*Message
Enter between 20 to 4,000 characters.
This is not what you are looking for? Post a Sourcing Request Now
Find Similar Products By Category:

Shenzhen Simeiquan Biotechnology Co., Ltd.

- Guangdong, China
- Trading Company

Gold Member Since 2014
Audited Supplier
  • Sample Available